| Product Number |
ARP32060_T100 |
| Product Page |
www.avivasysbio.com/pcsk6-antibody-n-terminal-region-arp32060-t100.html |
| Name |
PCSK6 Antibody - N-terminal region (ARP32060_T100) |
| Protein Size (# AA) |
623 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
5046 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Proprotein convertase subtilisin/kexin type 6 |
| Alias Symbols |
SPC4, PACE4 |
| Peptide Sequence |
Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Koide,S., et al., (2003) J. Biochem. 134 (3), 433-440 |
| Description of Target |
PCSK6 is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. This gene is thought to play a role in tumor progression. |
| Protein Interactions |
env; UBC; CACNA1A; RCN3; FLG; PMCH; PCSK6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PCSK6 (ARP32060_T100) antibody |
| Blocking Peptide |
For anti-PCSK6 (ARP32060_T100) antibody is Catalog # AAP32060 (Previous Catalog # AAPP02962) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PCSK6 |
| Uniprot ID |
P29122-5 |
| Protein Name |
Proprotein convertase subtilisin/kexin type 6 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that PCSK6 is expressed in HepG2 |
| Protein Accession # |
NP_612196 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_138323 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PCSK6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PCSK6 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PCSK6 is expressed in HepG2 |
|
