CNOT2 Antibody - middle region (ARP32048_T100)

• Product Number: ARP32048_T100
• Name: CNOT2 Antibody - middle region (ARP32048_T100)
• Protein Size (# AA): 365 amino acids
• Molecular Weight: 40kDa
• Subunit: 2
• NCBI Gene Id: 4848
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: CCR4-NOT transcription complex, subunit 2
• Alias Symbols: NOT2, CDC36, NOT2H, HSPC131, IDNADFS
• Peptide Sequence: Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Liu,B., et al., Submitted (15-DEC-1998)
• Description of Target: CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.
• Protein Interactions: UBC; RNF219; NLK; CNOT6L; CNOT6; VCP; Cnot3; NCOR2; NCOR1; HDAC3; GPS2; DDB1; CNOT1; CNOT8; CDC39;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CNOT2 (ARP32048_T100) antibody is Catalog # AAP32048 (Previous Catalog # AAPP02950)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT2
• Uniprot ID: Q9NZN8-2
• Protein Name: CCR4-NOT transcription complex subunit 2
• Protein Accession #: AAG39297
• Purification: Protein A purified
• Nucleotide Accession #: NM_001199302
• Tested Species Reactivity: Human
• Gene Symbol: CNOT2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Liver
  
  WB Suggested Anti-CNOT2 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:12500
  Positive Control: Human Liver