NAB1 Antibody - N-terminal region (ARP32032_P050)

Data Sheet
 
Product Number ARP32032_P050
Product Page www.avivasysbio.com/nab1-antibody-n-terminal-region-arp32032-p050.html
Name NAB1 Antibody - N-terminal region (ARP32032_P050)
Protein Size (# AA) 487 amino acids
Molecular Weight 54kDa
NCBI Gene Id 4664
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NGFI-A binding protein 1 (EGR1 binding protein 1)
Peptide Sequence Synthetic peptide located within the following region: ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716
Description of Target NAB1 belongs to the NAB family and acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2.
Protein Interactions ELAVL1; SUMO2; CHD4; POU2AF1; EGR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NAB1 (ARP32032_P050) antibody
Blocking Peptide For anti-NAB1 (ARP32032_P050) antibody is Catalog # AAP32032 (Previous Catalog # AAPP02934)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NAB1
Uniprot ID Q13506
Protein Name NGFI-A-binding protein 1
Publications

Shimoyamada, H. et al. Early growth response-1 induces and enhances vascular endothelial growth factor-A expression in lung cancer cells. Am. J. Pathol. 177, 70-83 (2010). 20489156

Protein Accession # NP_005957
Purification Affinity Purified
Nucleotide Accession # NM_005966
Tested Species Reactivity Human
Gene Symbol NAB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
r-NAB1
WB Suggested Anti-NAB1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Image 2
Human Prostate
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-NAB1 antibody (ARP32032_P050)
Image 3
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com