Product Number |
ARP32032_P050 |
Product Page |
www.avivasysbio.com/nab1-antibody-n-terminal-region-arp32032-p050.html |
Name |
NAB1 Antibody - N-terminal region (ARP32032_P050) |
Protein Size (# AA) |
487 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
4664 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NGFI-A binding protein 1 (EGR1 binding protein 1) |
Peptide Sequence |
Synthetic peptide located within the following region: ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716 |
Description of Target |
NAB1 belongs to the NAB family and acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. |
Protein Interactions |
ELAVL1; SUMO2; CHD4; POU2AF1; EGR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NAB1 (ARP32032_P050) antibody |
Blocking Peptide |
For anti-NAB1 (ARP32032_P050) antibody is Catalog # AAP32032 (Previous Catalog # AAPP02934) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NAB1 |
Uniprot ID |
Q13506 |
Protein Name |
NGFI-A-binding protein 1 |
Publications |
Shimoyamada, H. et al. Early growth response-1 induces and enhances vascular endothelial growth factor-A expression in lung cancer cells. Am. J. Pathol. 177, 70-83 (2010). 20489156 |
Protein Accession # |
NP_005957 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005966 |
Tested Species Reactivity |
Human |
Gene Symbol |
NAB1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | r-NAB1
| WB Suggested Anti-NAB1 Antibody Titration: 0.2-1 ug/ml Positive Control: Transfected 293T |
|
Image 2 | Human Prostate
| Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-NAB1 antibody (ARP32032_P050) |
|
Image 3 | Human Intestine
| Human Intestine |
|