LMX1A Antibody - middle region (ARP31999_P050)

Data Sheet
 
Product Number ARP31999_P050
Product Page www.avivasysbio.com/lmx1a-antibody-middle-region-arp31999-p050.html
Name LMX1A Antibody - middle region (ARP31999_P050)
Protein Size (# AA) 382 amino acids
Molecular Weight 43kDa
NCBI Gene Id 4009
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name LIM homeobox transcription factor 1, alpha
Alias Symbols LMX1, DFNA7, LMX1.1
Peptide Sequence Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Millen,K.J., et al., (2004) Dev. Biol. 270 (2), 382-392
Description of Target Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin. Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al., 1994 [PubMed 7698771]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-199 AL160058.8 14249-14447 c 200-2447 AK127724.1 362-2609 2448-3382 AL390730.12 9415-10349 c
Protein Interactions LDB1; BMPR2; ISL1; LHX3; LMX1A; TCF3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LMX1A (ARP31999_P050) antibody
Blocking Peptide For anti-LMX1A (ARP31999_P050) antibody is Catalog # AAP31999 (Previous Catalog # AAPP02896)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LMX1A
Uniprot ID Q8TE12
Protein Name LIM homeobox transcription factor 1-alpha
Protein Accession # NP_796372
Purification Affinity Purified
Nucleotide Accession # NM_177398
Tested Species Reactivity Human
Gene Symbol LMX1A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human 721_B
Host: Rabbit
Target Name: TRIM10
Sample Type: 721_B
Antibody Dilution: 1.0ug/ml
Image 2
Human MCF7
Host: Rabbit
Target Name: LMX1A
Sample Type: MCF7
Antibody Dilution: 1.0ug/ml
Image 3
Human 721_B
WB Suggested Anti-LMX1A Antibody
Titration: 1 ug/ml
Positive Control: 721_B Whole Cell
Image 4
Human Skeletal muscle
Rabbit Anti-LMX1A Antibody
Catalog Number: ARP31999
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com