Product Number |
ARP31999_P050 |
Product Page |
www.avivasysbio.com/lmx1a-antibody-middle-region-arp31999-p050.html |
Name |
LMX1A Antibody - middle region (ARP31999_P050) |
Protein Size (# AA) |
382 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
4009 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
LIM homeobox transcription factor 1, alpha |
Alias Symbols |
LMX1, DFNA7, LMX1.1 |
Peptide Sequence |
Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Millen,K.J., et al., (2004) Dev. Biol. 270 (2), 382-392 |
Description of Target |
Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin. Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al., 1994 [PubMed 7698771]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-199 AL160058.8 14249-14447 c 200-2447 AK127724.1 362-2609 2448-3382 AL390730.12 9415-10349 c |
Protein Interactions |
LDB1; BMPR2; ISL1; LHX3; LMX1A; TCF3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LMX1A (ARP31999_P050) antibody |
Blocking Peptide |
For anti-LMX1A (ARP31999_P050) antibody is Catalog # AAP31999 (Previous Catalog # AAPP02896) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LMX1A |
Uniprot ID |
Q8TE12 |
Protein Name |
LIM homeobox transcription factor 1-alpha |
Protein Accession # |
NP_796372 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_177398 |
Tested Species Reactivity |
Human |
Gene Symbol |
LMX1A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
Image 1 | Human 721_B
| Host: Rabbit Target Name: TRIM10 Sample Type: 721_B Antibody Dilution: 1.0ug/ml |
|
Image 2 | Human MCF7
| Host: Rabbit Target Name: LMX1A Sample Type: MCF7 Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human 721_B
| WB Suggested Anti-LMX1A Antibody Titration: 1 ug/ml Positive Control: 721_B Whole Cell |
|
Image 4 | Human Skeletal muscle
| Rabbit Anti-LMX1A Antibody Catalog Number: ARP31999 Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|