| Product Number |
ARP31985_T100 |
| Product Page |
www.avivasysbio.com/znf81-antibody-middle-region-arp31985-t100.html |
| Name |
ZNF81 Antibody - middle region (ARP31985_T100) |
| Protein Size (# AA) |
661 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
347344 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 81 |
| Alias Symbols |
HFZ20, MRX45, dJ54B20.6 |
| Peptide Sequence |
Synthetic peptide located within the following region: QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Marino,M., et al., (1993) Mamm. Genome 4 (5), 252-257 |
| Description of Target |
Zinc Finger Protein 81 is a new candidate transcription factor. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF81 (ARP31985_T100) antibody |
| Blocking Peptide |
For anti-ZNF81 (ARP31985_T100) antibody is Catalog # AAP31985 (Previous Catalog # AAPP02882) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF81 |
| Uniprot ID |
P51508 |
| Protein Name |
Zinc finger protein 81 |
| Purification |
Protein A purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF81 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Liver
 | Human Liver |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-ZNF81 Antibody Titration: 0.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
