website statistics
Product Datasheet: ARP31981_P050 - BARHL2 antibody - middle region (ARP31981_P050) - Aviva Systems Biology
BARHL2 antibody - middle region (ARP31981_P050)
Data Sheet
Product Number ARP31981_P050
Product Page
Product Name BARHL2 antibody - middle region (ARP31981_P050)
Size 100 ul
Gene Symbol BARHL2
Protein Size (# AA) 387 amino acids
Molecular Weight 42kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 343472
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name BarH-like homeobox 2
Description This is a rabbit polyclonal antibody against BARHL2. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG
Target Reference Bulfone,A.,et al.,(2000) Hum.Mol.Genet.9(9),1443-1452
Description of Target BARHL2 and BARHL1 are two homeobox genes in mouse and human, which are highly related to the Bar Drosophila genes.
Protein Interactions REL;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-BARHL2 (ARP31981_P050) antibody is Catalog # AAP31981 (Previous Catalog # AAPP02878)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BARHL2
Complete computational species homology data Anti-BARHL2 (ARP31981_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BARHL2.
Swissprot Id Q9NY43
Protein Name BarH-like 2 homeobox protein
Protein Accession # NP_064447
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BARHL2.
Nucleotide Accession # NM_020063
Replacement Item This antibody may replace item sc-130971 from Santa Cruz Biotechnology.
Conjugation Options

ARP31981_P050-FITC Conjugated

ARP31981_P050-HRP Conjugated

ARP31981_P050-Biotin Conjugated

CB Replacement sc-130971; sc-62010; sc-62011; sc-67519; sc-67521; sc-68370
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 77%
Image 1
Human Lung
Human Lung
Image 2
Human kidney
Human kidney
Image 3
Human HepG2
WB Suggested Anti-BARHL2 Antibody Titration: 0.05-2.0ug/ml
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |