Product Number |
ARP31975_P050 |
Product Page |
www.avivasysbio.com/jmjd8-antibody-middle-region-arp31975-p050.html |
Name |
JMJD8 Antibody - middle region (ARP31975_P050) |
Protein Size (# AA) |
285 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
339123 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Jumonji domain containing 8 |
Alias Symbols |
PP14397, C16orf20 |
Peptide Sequence |
Synthetic peptide located within the following region: FGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Daniels,R.J., et al., (2001) Hum.Mol.Genet.10(4),339-352 |
Description of Target |
LOC339123 is a candidate transcription factor located on chromosome 16. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-JMJD8 (ARP31975_P050) antibody |
Blocking Peptide |
For anti-JMJD8 (ARP31975_P050) antibody is Catalog # AAP31975 (Previous Catalog # AAPP02872) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC339123 |
Uniprot ID |
B2RNS7 |
Protein Name |
JmjC domain-containing protein 8 |
Protein Accession # |
NP_001005920 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001005920 |
Tested Species Reactivity |
Human |
Gene Symbol |
JMJD8 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92% |
Image 1 | Human Spermatophore
| Human Spermatophore |
| Image 2 | Human Jurkat
| WB Suggested Anti-JMJD8 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
| Image 3 | Human Muscle
| HumanMuscle |
|
|