JMJD8 Antibody - middle region (ARP31975_P050)

Data Sheet
 
Product Number ARP31975_P050
Product Page www.avivasysbio.com/jmjd8-antibody-middle-region-arp31975-p050.html
Name JMJD8 Antibody - middle region (ARP31975_P050)
Protein Size (# AA) 285 amino acids
Molecular Weight 32kDa
NCBI Gene Id 339123
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Jumonji domain containing 8
Alias Symbols PP14397, C16orf20
Peptide Sequence Synthetic peptide located within the following region: FGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Daniels,R.J., et al., (2001) Hum.Mol.Genet.10(4),339-352
Description of Target LOC339123 is a candidate transcription factor located on chromosome 16.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-JMJD8 (ARP31975_P050) antibody
Blocking Peptide For anti-JMJD8 (ARP31975_P050) antibody is Catalog # AAP31975 (Previous Catalog # AAPP02872)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LOC339123
Uniprot ID B2RNS7
Protein Name JmjC domain-containing protein 8
Protein Accession # NP_001005920
Purification Affinity Purified
Nucleotide Accession # NM_001005920
Tested Species Reactivity Human
Gene Symbol JMJD8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%
Image 1
Human Spermatophore
Human Spermatophore
Image 2
Human Jurkat
WB Suggested Anti-JMJD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Image 3
Human Muscle
HumanMuscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com