HNF4G Antibody - C-terminal region (ARP31947_P050)

Data Sheet
 
Product Number ARP31947_P050
Product Page www.avivasysbio.com/hnf4g-antibody-c-terminal-region-arp31947-p050.html
Name HNF4G Antibody - C-terminal region (ARP31947_P050)
Protein Size (# AA) 408 amino acids
Molecular Weight 46kDa
NCBI Gene Id 3174
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Hepatocyte nuclear factor 4, gamma
Alias Symbols NR2A2, NR2A3
Peptide Sequence Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ozeki,T., et al., (2003) Pharmacogenetics 13 (1), 49-53
Description of Target HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse
Protein Interactions NSD1; NCOA1; PNRC2; COPS5; PNRC1; HAX1; RANBP9; PRDX6; EIF3I; NR0B2; TNNI2; SRC; GAPDH; HLF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HNF4G (ARP31947_P050) antibody
Blocking Peptide For anti-HNF4G (ARP31947_P050) antibody is Catalog # AAP31947 (Previous Catalog # AAPP02844)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HNF4G
Uniprot ID Q7Z2V9
Protein Name Hepatocyte nuclear factor 4-gamma
Sample Type Confirmation

HNF4G is supported by BioGPS gene expression data to be expressed in Daudi

Protein Accession # NP_004124
Purification Affinity Purified
Nucleotide Accession # NM_004133
Tested Species Reactivity Human
Gene Symbol HNF4G
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human Daudi
WB Suggested Anti-HNF4G Antibody Titration: 0.2-1 ug/ml
Positive Control: Daudi cell lysateHNF4G is supported by BioGPS gene expression data to be expressed in Daudi
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com