Product Number |
ARP31945_P050 |
Product Page |
www.avivasysbio.com/foxa3-antibody-middle-region-arp31945-p050.html |
Name |
FOXA3 Antibody - middle region (ARP31945_P050) |
Protein Size (# AA) |
350 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
3171 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Forkhead box A3 |
Alias Symbols |
FKHH3, HNF3G, TCF3G |
Peptide Sequence |
Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kaestner,K.H. et al., (2000) Trends Endocrinol. Metab. 11 (7), 281-285 |
Description of Target |
FOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. |
Protein Interactions |
PPARA; ALX4; TLE2; TLE1; HMGB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXA3 (ARP31945_P050) antibody |
Blocking Peptide |
For anti-FOXA3 (ARP31945_P050) antibody is Catalog # AAP31945 (Previous Catalog # AAPP03641) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FOXA3 |
Uniprot ID |
P55318 |
Protein Name |
Hepatocyte nuclear factor 3-gamma |
Publications |
Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). 22959654 |
Protein Accession # |
NP_004488 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004497 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
FOXA3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human Jurkat
| WB Suggested Anti-FOXA3 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human Lung
| Human Lung |
|
Image 3 | Mouse Skeletal Muscle
| Host: Mouse Target Name: FOXA3 Sample Tissue: Mouse Skeletal Muscle Antibody Dilution: 1ug/ml |
|
Image 4 | Mouse Skeletal Muscle
| Host: Rabbit Target Name: FOXA3 Sample Tissue: Mouse Skeletal Muscle Antibody Dilution: 1ug/ml |
|