| Product Number |
ARP31937_P050 |
| Product Page |
www.avivasysbio.com/zbtb48-antibody-n-terminal-region-arp31937-p050.html |
| Name |
ZBTB48 Antibody - N-terminal region (ARP31937_P050) |
| Protein Size (# AA) |
688 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
3104 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 48 |
| Alias Symbols |
HKR3, TZAP, ZNF855, pp9964 |
| Peptide Sequence |
Synthetic peptide located within the following region: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Maris,J.M., (1996) Genomics 35 (2), 289-298 |
| Description of Target |
ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter. |
| Protein Interactions |
ZBTB8A; KRTAP10-5; GPATCH2L; NME7; ZBTB48; ZBTB7A; EP300; UPF2; CDK2AP2; TNFRSF14; RGS2; ILK; CDKN1A; PNRC2; NUDT21; C11orf58; C7orf34; ZBTB8B; DVL3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB48 (ARP31937_P050) antibody |
| Blocking Peptide |
For anti-ZBTB48 (ARP31937_P050) antibody is Catalog # AAP31937 (Previous Catalog # AAPS32604) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB48 |
| Uniprot ID |
P10074 |
| Protein Name |
Zinc finger and BTB domain-containing protein 48 |
| Publications |
Kim, K. et al. Induction of the transcriptional repressor ZBTB4 in prostate cancer cells by drug-induced targeting of microRNA-17-92/106b-25 clusters. Mol. Cancer Ther. 11, 1852-62 (2012). 22752225 |
| Sample Type Confirmation |
ZBTB48 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_005332 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005341 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB48 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | r-ZBTB48
 | WB Suggested Anti-ZBTB48 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
| Image 2 | Human 293T
 | Host: Rabbit
Target Name: ZBTB48
Sample Type: 293T
Antibody Dilution: 1.0ug/mlZBTB48 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
