TBX21 Antibody - N-terminal region (ARP31924_T100)

• Product Number: ARP31924_T100
• Name: TBX21 Antibody - N-terminal region (ARP31924_T100)
• Protein Size (# AA): 535 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 30009
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: T-box 21
• Alias Symbols: TBET, T-PET, T-bet, TBLYM
• Peptide Sequence: Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Johrens,K., et al., (2006) Histopathology 48 (4), 343-352
• Description of Target: TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Expression of the human TBX21 correlates w
• Protein Interactions: USP10; UBC; EXOC5; ZNF490; SP1; HOXC11; GATA3; EP300; CREBBP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TBX21 (ARP31924_T100) antibody is Catalog # AAP31924 (Previous Catalog # AAPP02821)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX21
• Uniprot ID: Q9UL17
• Protein Name: T-box transcription factor TBX21
• Protein Accession #: NP_037483
• Purification: Protein A purified
• Nucleotide Accession #: NM_013351
• Tested Species Reactivity: Human
• Gene Symbol: TBX21
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 85%; Human: 100%; Mouse: 77%; Pig: 85%
• Image 1: Human Thymus
  
  WB Suggested Anti-TBX21 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Thymus