Product Number |
ARP31924_T100 |
Product Page |
www.avivasysbio.com/tbx21-antibody-n-terminal-region-arp31924-t100.html |
Name |
TBX21 Antibody - N-terminal region (ARP31924_T100) |
Protein Size (# AA) |
535 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
30009 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
T-box 21 |
Alias Symbols |
TBET, T-PET, T-bet, TBLYM |
Peptide Sequence |
Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Johrens,K., et al., (2006) Histopathology 48 (4), 343-352 |
Description of Target |
TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Expression of the human TBX21 correlates w |
Protein Interactions |
USP10; UBC; EXOC5; ZNF490; SP1; HOXC11; GATA3; EP300; CREBBP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TBX21 (ARP31924_T100) antibody |
Blocking Peptide |
For anti-TBX21 (ARP31924_T100) antibody is Catalog # AAP31924 (Previous Catalog # AAPP02821) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX21 |
Uniprot ID |
Q9UL17 |
Protein Name |
T-box transcription factor TBX21 |
Protein Accession # |
NP_037483 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_013351 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBX21 |
Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 85%; Human: 100%; Mouse: 77%; Pig: 85% |
Image 1 | Human Thymus
| WB Suggested Anti-TBX21 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Human Thymus |
|
|