| Product Number |
ARP31918_P050 |
| Product Page |
www.avivasysbio.com/tfcp2l1-antibody-n-terminal-region-arp31918-p050.html |
| Name |
TFCP2L1 Antibody - N-terminal region (ARP31918_P050) |
| Protein Size (# AA) |
479 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
29842 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor CP2-like 1 |
| Alias Symbols |
LBP9, CRTR1, LBP-9 |
| Peptide Sequence |
Synthetic peptide located within the following region: LRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rodda,S., et al., (2001) Biol. Chem. 276 (5), 3324-3332 |
| Description of Target |
TFCP2L1 is a candidate CP2 family member. It is expressed in a developmentally regulated fashion in vivo and acts as a direct repressor of transcription. CP2-related proteins comprise a family of DNA-binding transcription factors that are generally activators of transcription and expressed ubiquitously. |
| Protein Interactions |
CFAP20; RBM8A; TFAP4; TFCP2L1; UBP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFCP2L1 (ARP31918_P050) antibody |
| Blocking Peptide |
For anti-TFCP2L1 (ARP31918_P050) antibody is Catalog # AAP31918 (Previous Catalog # AAPP02815) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TFCP2L1 |
| Uniprot ID |
Q9NZI6 |
| Protein Name |
Transcription factor CP2-like protein 1 |
| Protein Accession # |
NP_055368 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014553 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TFCP2L1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 75% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TFCP2L1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human Muscle
 | HumanMuscle |
|
| Image 3 | Human Spermatophore
 | Human Spermatophore |
|
| Image 4 | Human Fetal Heart
 | Host: Rabbit
Target Name: TFCP2L1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml |
|
| Image 5 | Human Fetal Lung
 | Host: Rabbit
Target Name: TFCP2L1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
