RACGAP1 Antibody - N-terminal region (ARP31905_T100)

Data Sheet
 
Product Number ARP31905_T100
Product Page www.avivasysbio.com/racgap1-antibody-n-terminal-region-arp31905-t100.html
Name RACGAP1 Antibody - N-terminal region (ARP31905_T100)
Protein Size (# AA) 632 amino acids
Molecular Weight 71kDa
NCBI Gene Id 29127
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Rac GTPase activating protein 1
Alias Symbols CYK4, ID-GAP, HsCYK-4, MgcRacGAP
Peptide Sequence Synthetic peptide located within the following region: EILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Niiya,F., et al., (2005) J. Biol. Chem. 280 (43), 36502-36509
Description of Target Rho GTPases control a variety of cellular processes. There are 3 subtypes of Rho GTPases in the Ras superfamily of small G proteins: RHO, RAC, and CDC42. GTPase-activating proteins (GAPs) bind activated forms of Rho GTPases and stimulate GTP hydrolysis. Through this catalytic function, Rho GAPs negatively regulate Rho-mediated signals. GAPs may also serve as effector molecules and play a role in signaling downstream of Rho and other Ras-like GTPases.
Protein Interactions MORF4L1; UBC; FZR1; MPG; TXNDC11; MPRIP; TANK; KIF23; AURKB; PPP2R4; ECT2; CDK1; IKBKG; CUL1; SH3KBP1; Racgap1; Shcbp1; Cd2ap; YWHAG; YWHAB; PRC1; SH3RF1; SLC26A8; SLC16A10; PRSS23; CHN2; MAP3K4; RND2; MAP3K10; TUBG1; TUBA4A; VAV1; NRAS; GRB2; SFN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RACGAP1 (ARP31905_T100) antibody
Blocking Peptide For anti-RACGAP1 (ARP31905_T100) antibody is Catalog # AAP31905 (Previous Catalog # AAPP02982)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RACGAP1
Uniprot ID Q9H0H5
Protein Name Rac GTPase-activating protein 1
Protein Accession # NP_037409
Purification Protein A purified
Nucleotide Accession # NM_013277
Tested Species Reactivity Human
Gene Symbol RACGAP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-RACGAP1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com