Product Number |
ARP31890_T100 |
Product Page |
www.avivasysbio.com/znf620-antibody-c-terminal-region-arp31890-t100.html |
Name |
ZNF620 Antibody - C-terminal region (ARP31890_T100) |
Protein Size (# AA) |
422 amino acids |
Molecular Weight |
49kDa |
NCBI Gene Id |
253639 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 620 |
Peptide Sequence |
Synthetic peptide located within the following region: SQSAILNQHRRIHTGAKPYECGQCGKSFSQKATLIKHQRVHTGERPYKCG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Isogai,T. Unpublished (2004) |
Description of Target |
ZNF620 is a new candidate transcription factor |
Protein Interactions |
CBX5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF620 (ARP31890_T100) antibody |
Blocking Peptide |
For anti-ZNF620 (ARP31890_T100) antibody is Catalog # AAP31890 (Previous Catalog # AAPP02685) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF620 |
Uniprot ID |
Q6ZNG0 |
Protein Name |
Zinc finger protein 620 |
Protein Accession # |
NP_787084 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_175888 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF620 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human Thymus
| WB Suggested Anti-ZNF620 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Human Thymus |
|
|