ZBTB32 Antibody - N-terminal region (ARP31874_P050)

• Product Number: ARP31874_P050
• Name: ZBTB32 Antibody - N-terminal region (ARP31874_P050)
• Protein Size (# AA): 302 amino acids
• Molecular Weight: 33 kDa
• Conjugation: Unconjugated
• NCBI Gene Id: 27033
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger and BTB domain containing 32
• Alias Symbols: Rog, FAXF, FAZF, TZFP, ZNF538
• Peptide Sequence: Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hoatlin,M.E., et al., (1999) Blood. 94 -11 3737-47
• Description of Target: ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.
• Protein Interactions: DAB1; RHOXF2; RBPMS; MLX; MVP; PRKAB2; PITX1; FMOD; ERVK-6; Hoxa1; AR; ATXN1; ZNF490; HOXD4; ELF2; ZBTB16; TXNIP; FANCC; GATA2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZBTB32 (ARP31874_P050) antibody is Catalog # AAP31874 (Previous Catalog # AAPP02669)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB32
• Uniprot ID: Q8WVP2
• Protein Name: Zinc finger and BTB domain-containing protein 32
• Sample Type Confirmation:

  ZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B

• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: ZBTB32
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:2500
  Positive Control: HepG2 cell lysate
• Image 2: Human DLD1 Whole Cell
  
  Host: Rabbit
  Target Name: ZBTB32
  Sample Tissue: Human DLD1 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 3: Human 721_B
  
  Host: Rabbit
  Target Name: WT1
  Sample Type: 721_B
  Antibody Dilution: 1.0ug/mlZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B
• Image 4:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.