| Product Number |
ARP31869_P050 |
| Product Page |
www.avivasysbio.com/gfi1-antibody-n-terminal-region-arp31869-p050.html |
| Name |
GFI1 Antibody - N-terminal region (ARP31869_P050) |
| Protein Size (# AA) |
422 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
2672 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Growth factor independent 1 transcription repressor |
| Alias Symbols |
SCN2, GFI-1, GFI1A, ZNF163 |
| Peptide Sequence |
Synthetic peptide located within the following region: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Duan,Z., et al., (2005) Mol. Cell. Biol. 25 (23), 10338-10351 |
| Description of Target |
GFI1 may be a transcription factor involved in regulating the expression of genes active in the S phase during cell cycle progression in T-cells. GFI1 may be involved in tumor progression. Defects in GFI1 are a cause of autosomal dominant severe congenital neutropenia (SCN) and dominant nonimmune chronic idiopathic neutropenia of adults (NI-CINA) |
| Protein Interactions |
RELA; SPI1; CHAF1A; PICK1; PIAS2; RCOR1; KDM1A; HDAC2; PRDM5; HDAC1; EHMT2; PIAS3; RUNX1T1; ARIH2; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GFI1 (ARP31869_P050) antibody |
| Blocking Peptide |
For anti-GFI1 (ARP31869_P050) antibody is Catalog # AAP31869 (Previous Catalog # AAPP02664) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GFI1 |
| Uniprot ID |
Q99684 |
| Protein Name |
Zinc finger protein Gfi-1 |
| Protein Accession # |
NP_005254 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005263 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
GFI1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-GFI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
| Image 2 | Mouse Liver
 | Host: Mouse
Target Name: GFI1
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml |
|
