GBX2 Antibody - middle region (ARP31862_T100)

• Product Number: ARP31862_T100
• Name: GBX2 Antibody - middle region (ARP31862_T100)
• Protein Size (# AA): 348 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 2637
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Gastrulation brain homeobox 2
• Peptide Sequence: Synthetic peptide located within the following region: QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kowenz-Leutz,E., et al., (1997) Cell 91 (2), 185-195
• Description of Target: Altered expression of GBX2, part of the homeobox-containing human family of DNA-binding transcription factors, is associated with therapy failure and death in patients with multiple types of cancer.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GBX2 (ARP31862_T100) antibody is Catalog # AAP31862 (Previous Catalog # AAPP02657)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GBX2
• Uniprot ID: P52951
• Protein Name: Homeobox protein GBX-2
• Protein Accession #: NP_001476
• Purification: Protein A purified
• Nucleotide Accession #: NM_001485
• Tested Species Reactivity: Human
• Gene Symbol: GBX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-GBX2 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate