Product Number |
ARP31856_P050 |
Product Page |
www.avivasysbio.com/nkx2-8-antibody-c-terminal-region-arp31856-p050.html |
Name |
NKX2-8 Antibody - C-terminal region (ARP31856_P050) |
Protein Size (# AA) |
239 amino acids |
Molecular Weight |
26kDa |
NCBI Gene Id |
26257 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NK2 homeobox 8 |
Alias Symbols |
NKX2H, NKX2.8, Nkx2-9 |
Peptide Sequence |
Synthetic peptide located within the following region: GTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kajiyama,Y., et al., (2002) Mol. Cell. Biol. 22 (17), 6122-6130 |
Description of Target |
A murine NKX2-8 was isolated from the Hepal-6 cell line and showed oligonucleotide binding competitive with fetoprotein transcription factor. Nkx2.8 bound to the active AFP promoter, and antisense inhibition of Nkx2.8 mRNA translation selectively reduced expression of both the endogenous human AFP gene and transfected reporters containing the rat AFP promoter. |
Protein Interactions |
NKX2-8; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NKX2-8 (ARP31856_P050) antibody |
Blocking Peptide |
For anti-NKX2-8 (ARP31856_P050) antibody is Catalog # AAP31856 (Previous Catalog # AAPS08205) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NKX2-8 |
Uniprot ID |
O15522 |
Protein Name |
Homeobox protein Nkx-2.8 |
Protein Accession # |
NP_055175 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014360 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
NKX2-8 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Heart
| WB Suggested Anti-NKX2-8 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human heart |
|
Image 2 | Mouse Heart
| Host: Mouse Target Name: NKX2-8 Sample Tissue: Mouse Heart Antibody Dilution: 1ug/ml |
|
Image 3 | Human Fetal Heart
| Host: Rabbit Target Name: NKX2-8 Sample Type: Human Fetal Heart Antibody Dilution: 1.0ug/ml |
|
Image 4 | Human Fetal Liver
| Host: Rabbit Target Name: NKX2-8 Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 5 | Human Fetal Lung
| Host: Rabbit Target Name: NKX2-8 Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 6 | Human Adult Placenta
| Host: Rabbit Target Name: NKX2-8 Sample Type: Human Adult Placenta Antibody Dilution: 1.0ug/ml |
|