NKX2-8 Antibody - C-terminal region (ARP31856_P050)

Data Sheet
 
Product Number ARP31856_P050
Product Page www.avivasysbio.com/nkx2-8-antibody-c-terminal-region-arp31856-p050.html
Name NKX2-8 Antibody - C-terminal region (ARP31856_P050)
Protein Size (# AA) 239 amino acids
Molecular Weight 26kDa
NCBI Gene Id 26257
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NK2 homeobox 8
Alias Symbols NKX2H, NKX2.8, Nkx2-9
Peptide Sequence Synthetic peptide located within the following region: GTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kajiyama,Y., et al., (2002) Mol. Cell. Biol. 22 (17), 6122-6130
Description of Target A murine NKX2-8 was isolated from the Hepal-6 cell line and showed oligonucleotide binding competitive with fetoprotein transcription factor. Nkx2.8 bound to the active AFP promoter, and antisense inhibition of Nkx2.8 mRNA translation selectively reduced expression of both the endogenous human AFP gene and transfected reporters containing the rat AFP promoter.
Protein Interactions NKX2-8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NKX2-8 (ARP31856_P050) antibody
Blocking Peptide For anti-NKX2-8 (ARP31856_P050) antibody is Catalog # AAP31856 (Previous Catalog # AAPS08205)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NKX2-8
Uniprot ID O15522
Protein Name Homeobox protein Nkx-2.8
Protein Accession # NP_055175
Purification Affinity Purified
Nucleotide Accession # NM_014360
Tested Species Reactivity Human, Mouse
Gene Symbol NKX2-8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100%
Image 1
Human Heart
WB Suggested Anti-NKX2-8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart
Image 2
Mouse Heart
Host: Mouse
Target Name: NKX2-8
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml
Image 3
Human Fetal Heart
Host: Rabbit
Target Name: NKX2-8
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml
Image 4
Human Fetal Liver
Host: Rabbit
Target Name: NKX2-8
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 5
Human Fetal Lung
Host: Rabbit
Target Name: NKX2-8
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 6
Human Adult Placenta
Host: Rabbit
Target Name: NKX2-8
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com