| Product Number |
ARP31853_T100 |
| Product Page |
www.avivasysbio.com/zbtb20-antibody-middle-region-arp31853-t100.html |
| Name |
ZBTB20 Antibody - middle region (ARP31853_T100) |
| Protein Size (# AA) |
741 amino acids |
| Molecular Weight |
81 kDa |
| NCBI Gene Id |
26137 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 20 |
| Alias Symbols |
HOF, DPZF, PRIMS, ODA-8S, ZNF288 |
| Peptide Sequence |
Synthetic peptide located within the following region: SNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,W., et al., (2001) Biochem. Biophys. Res. Commun. 282 (4), 1067-1073 |
| Description of Target |
ZBTB20 is a 733-residue protein with a BTB/POZ domain at the N-terminal and 4 C2H2 zinc fingers at C-terminal. It is localized on chromosome 3. It is widely expressed in hematopoietic tissues |
| Protein Interactions |
HSP90AA1; ELAVL1; CHD7; PPARG; NR3C1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB20 (ARP31853_T100) antibody |
| Blocking Peptide |
For anti-ZBTB20 (ARP31853_T100) antibody is Catalog # AAP31853 (Previous Catalog # AAPP02648) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZBTB20 |
| Uniprot ID |
Q9HC78 |
| Protein Name |
Zinc finger and BTB domain-containing protein 20 |
| Protein Accession # |
NP_056457 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_015642 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB20 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92% |
| Image 1 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
