| Product Number |
ARP31852_P050 |
| Product Page |
www.avivasysbio.com/znf500-antibody-middle-region-arp31852-p050.html |
| Name |
ZNF500 Antibody - middle region (ARP31852_P050) |
| Protein Size (# AA) |
480 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
26048 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 500 |
| Alias Symbols |
ZSCAN50, ZKSCAN18 |
| Peptide Sequence |
Synthetic peptide located within the following region: TGERPYKCLVCGKGFSDRSNFSTHQRVHTGEKPYPCPECGKRFSQSSSLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., , (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
ZNF500 is a new candidate transcription factor. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF500 (ARP31852_P050) antibody |
| Blocking Peptide |
For anti-ZNF500 (ARP31852_P050) antibody is Catalog # AAP31852 (Previous Catalog # AAPP02647) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF500 |
| Uniprot ID |
O60304 |
| Protein Name |
Zinc finger protein 500 |
| Protein Accession # |
NP_067678 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021646 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF500 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Horse: 83%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 100%; Rat: 83%; Zebrafish: 82% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF500 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Spermatophore
 | Human Spermatophore |
| | Image 3 | Human Spleen
 | Human Spleen |
|
|
