ZNF385 Antibody - C-terminal region (ARP31849_P050)

Data Sheet
 
Product Number ARP31849_P050
Product Page www.avivasysbio.com/znf385-antibody-c-terminal-region-arp31849-p050.html
Name ZNF385 Antibody - C-terminal region (ARP31849_P050)
Protein Size (# AA) 366 amino acids
Molecular Weight 38kDa
NCBI Gene Id 25946
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 385A
Alias Symbols HZF, RZF, ZFP385, ZNF385
Peptide Sequence Synthetic peptide located within the following region: LKQHISSRRHRDGVAGKPNPLLSRHKKSRGAGELAGTLTFSKELPKSLAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sharma,S., et al., (2004) Gene 342 (2), 219-229
Description of Target Results suggest that RZF is a shuttling regulatory protein expressed in photoreceptors of the human retina that may be involved in mRNA or protein regulation of photoreceptor-specific genes and therefore have role in retinal disease mechanisms.
Protein Interactions CEP57;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF385A (ARP31849_P050) antibody
Blocking Peptide For anti-ZNF385A (ARP31849_P050) antibody is Catalog # AAP31849 (Previous Catalog # AAPP02644)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF385
Uniprot ID Q96PM9
Protein Name Zinc finger protein 385A
Protein Accession # NP_056296
Purification Affinity Purified
Nucleotide Accession # NM_015481
Tested Species Reactivity Human
Gene Symbol ZNF385A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Skin
Human Skin
Image 2
Human K562
WB Suggested Anti-ZNF385 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: K562 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com