| Product Number |
ARP31848_T100 |
| Product Page |
www.avivasysbio.com/c20orf194-antibody-c-terminal-region-arp31848-t100.html |
| Name |
C20ORF194 Antibody - C-terminal region (ARP31848_T100) |
| Protein Size (# AA) |
902 amino acids |
| Molecular Weight |
99kDa |
| NCBI Gene Id |
25943 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Chromosome 20 open reading frame 194 |
| Alias Symbols |
C20orf194 |
| Peptide Sequence |
Synthetic peptide located within the following region: FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg RL, et al., (2002) Proc Natl Acad Sci 99 (26), 16899-903 |
| Description of Target |
The function of the C20orf194 gene has not yet been determined. |
| Protein Interactions |
HSP90AA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C20ORF194 (ARP31848_T100) antibody |
| Blocking Peptide |
For anti-C20ORF194 (ARP31848_T100) antibody is Catalog # AAP31848 (Previous Catalog # AAPP02643) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human C20ORF194 |
| Uniprot ID |
Q5TEA3 |
| Protein Accession # |
XP_045421 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
XM_045421 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C20ORF194 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%; Yeast: 83% |
| Image 1 | Human Heart
 | WB Suggested Anti-C20ORF194 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
|
