| Product Number |
ARP31841_T100 |
| Product Page |
www.avivasysbio.com/spdef-antibody-n-terminal-region-arp31841-t100.html |
| Name |
SPDEF Antibody - N-terminal region (ARP31841_T100) |
| Protein Size (# AA) |
335 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
25803 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
SAM pointed domain containing ets transcription factor |
| Alias Symbols |
PDEF, bA375E1.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fowler,M., (2006) J. Cell. Biochem. 97 (1), 1-17 |
| Description of Target |
PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM]. |
| Protein Interactions |
STK11; NKX3-1; PCGF2; AR; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPDEF (ARP31841_T100) antibody |
| Blocking Peptide |
For anti-SPDEF (ARP31841_T100) antibody is Catalog # AAP31841 (Previous Catalog # AAPP23934) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SPDEF |
| Uniprot ID |
O95238 |
| Protein Name |
SAM pointed domain-containing Ets transcription factor |
| Sample Type Confirmation |
SPDEF is strongly supported by BioGPS gene expression data to be expressed in MCF7 |
| Protein Accession # |
NP_036523 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_012391 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SPDEF |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human MCF7
 | WB Suggested Anti-SPDEF Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: MCF7 cell lysateSPDEF is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells |
|
