Product Number |
ARP31837_T100 |
Product Page |
www.avivasysbio.com/ebf3-antibody-middle-region-arp31837-t100.html |
Name |
EBF3 Antibody - middle region (ARP31837_T100) |
Protein Size (# AA) |
551 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
253738 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Early B-cell factor 3 |
Alias Symbols |
COE3, OE-2, EBF-3, HADDS, O/E-2 |
Peptide Sequence |
Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex. |
Protein Interactions |
ZNF423; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EBF3 (ARP31837_T100) antibody |
Blocking Peptide |
For anti-EBF3 (ARP31837_T100) antibody is Catalog # AAP31837 (Previous Catalog # AAPP02632) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EBF3 |
Uniprot ID |
Q9H4W6 |
Protein Name |
Transcription factor COE3 |
Publications |
Bennett, K. L., Romigh, T. & Eng, C. Disruption of transforming growth factor-beta signaling by five frequently methylated genes leads to head and neck squamous cell carcinoma pathogenesis. Cancer Res. 69, 9301-5 (2009). 19934318 |
Protein Accession # |
NP_001005463 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001005463 |
Tested Species Reactivity |
Human |
Gene Symbol |
EBF3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Raji
| WB Suggested Anti-EBF3 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Raji cell lysate |
|