EBF3 Antibody - middle region (ARP31837_T100)

Data Sheet
 
Product Number ARP31837_T100
Product Page www.avivasysbio.com/ebf3-antibody-middle-region-arp31837-t100.html
Name EBF3 Antibody - middle region (ARP31837_T100)
Protein Size (# AA) 551 amino acids
Molecular Weight 60kDa
NCBI Gene Id 253738
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Early B-cell factor 3
Alias Symbols COE3, OE-2, EBF-3, HADDS, O/E-2
Peptide Sequence Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.
Protein Interactions ZNF423;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EBF3 (ARP31837_T100) antibody
Blocking Peptide For anti-EBF3 (ARP31837_T100) antibody is Catalog # AAP31837 (Previous Catalog # AAPP02632)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EBF3
Uniprot ID Q9H4W6
Protein Name Transcription factor COE3
Publications

Bennett, K. L., Romigh, T. & Eng, C. Disruption of transforming growth factor-beta signaling by five frequently methylated genes leads to head and neck squamous cell carcinoma pathogenesis. Cancer Res. 69, 9301-5 (2009). 19934318

Protein Accession # NP_001005463
Purification Protein A purified
Nucleotide Accession # NM_001005463
Tested Species Reactivity Human
Gene Symbol EBF3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Raji
WB Suggested Anti-EBF3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Raji cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com