| Product Number |
ARP31836_T100 |
| Product Page |
www.avivasysbio.com/znf620-antibody-middle-region-arp31836-t100.html |
| Name |
ZNF620 Antibody - middle region (ARP31836_T100) |
| Protein Size (# AA) |
422 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
253639 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 620 |
| Peptide Sequence |
Synthetic peptide located within the following region: TVHQRMHTGEKPYECKECGKRLSSNTALTQHQRIHTGEKPFECKECGKAF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Isogai,T., et al., Unpublished (2004) |
| Description of Target |
ZNF620 is a new candidate transcription factor |
| Protein Interactions |
CBX5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF620 (ARP31836_T100) antibody |
| Blocking Peptide |
For anti-ZNF620 (ARP31836_T100) antibody is Catalog # AAP31836 (Previous Catalog # AAPP02631) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF620 |
| Uniprot ID |
Q6ZNG0 |
| Protein Name |
Zinc finger protein 620 |
| Protein Accession # |
NP_787084 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_175888 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF620 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100% |
| Image 1 | Human Thymus
 | WB Suggested Anti-ZNF620 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus |
|
|
