ZFP95 Antibody - N-terminal region (ARP31830_T100)

• Product Number: ARP31830_T100
• Name: ZFP95 Antibody - N-terminal region (ARP31830_T100)
• Protein Size (# AA): 839 amino acids
• Molecular Weight: 97kDa
• NCBI Gene Id: 23660
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger with KRAB and SCAN domains 5
• Alias Symbols: ZFP95, ZFP-95, ZNF914, ZSCAN37
• Peptide Sequence: Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
• Description of Target: ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
• Protein Interactions: SUV39H1; THOC3; THOC5; TNNT1; ZSCAN1; ZBTB9;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZKSCAN5 (ARP31830_T100) antibody is Catalog # AAP31830 (Previous Catalog # AAPP02625)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95
• Uniprot ID: Q9Y2L8
• Protein Name: Zinc finger protein with KRAB and SCAN domains 5
• Protein Accession #: NP_055384
• Purification: Protein A purified
• Nucleotide Accession #: NM_014569
• Tested Species Reactivity: Human
• Gene Symbol: ZKSCAN5
• Predicted Species Reactivity: Human, Mouse, Dog, Guinea Pig, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZFP95 Antibody Titration: 1.0ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate