ZFP95 antibody - N-terminal region (ARP31830_T100)
Data Sheet
Product Number ARP31830_T100
Product Page www.avivasysbio.com/zfp95-antibody-n-terminal-region-arp31830-t100.html
Product Name ZFP95 antibody - N-terminal region (ARP31830_T100)
Size 100 ul
Gene Symbol ZKSCAN5
Alias Symbols ZFP95, ZNF914
Protein Size (# AA) 839 amino acids
Molecular Weight 97kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 23660
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger with KRAB and SCAN domains 5
Description This is a rabbit polyclonal antibody against ZFP95. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY
Target Reference Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
Description of Target ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
Protein Interactions SUV39H1; THOC3; THOC5; TNNT1; ZSCAN1; ZBTB9;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZKSCAN5 (ARP31830_T100) antibody is Catalog # AAP31830 (Previous Catalog # AAPP02625)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95
Complete computational species homology data Anti-ZFP95 (ARP31830_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZFP95.
Swissprot Id Q9Y2L8
Protein Name Zinc finger protein with KRAB and SCAN domains 5
Protein Accession # NP_055384
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZFP95.
Nucleotide Accession # NM_014569
Replacement Item This antibody may replace item sc-89452 from Santa Cruz Biotechnology.
Conjugation Options

ARP31830_T100-FITC Conjugated

ARP31830_T100-HRP Conjugated

ARP31830_T100-Biotin Conjugated

CB Replacement sc-89452
Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZFP95 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com