| Product Number |
ARP31825_P050 |
| Product Page |
www.avivasysbio.com/sec14l2-antibody-middle-region-arp31825-p050.html |
| Name |
SEC14L2 Antibody - middle region (ARP31825_P050) |
| Protein Size (# AA) |
403 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
23541 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SEC14-like 2 (S. cerevisiae) |
| Alias Symbols |
SPF, TAP, TAP1, C22orf6 |
| Peptide Sequence |
Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Collins,J.E., et al., (2004) Genome Biol. 5(10), R84 |
| Description of Target |
SEC14L2 encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. |
| Protein Interactions |
UBC; PIK3CG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SEC14L2 (ARP31825_P050) antibody |
| Blocking Peptide |
For anti-SEC14L2 (ARP31825_P050) antibody is Catalog # AAP31825 (Previous Catalog # AAPP02620) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SEC14L2 |
| Uniprot ID |
O76054 |
| Protein Name |
SEC14-like protein 2 |
| Protein Accession # |
NP_036561 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012429 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SEC14L2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 87%; Rabbit: 87%; Rat: 93% |
| Image 1 | Human Liver
 | WB Suggested Anti-SEC14L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:7812500
Positive Control: Human Liver |
|
|
