PTDSR Antibody - middle region (ARP31807_P050)

Data Sheet
 
Product Number ARP31807_P050
Product Page www.avivasysbio.com/ptdsr-antibody-middle-region-arp31807-p050.html
Name PTDSR Antibody - middle region (ARP31807_P050)
Protein Size (# AA) 372 amino acids
Molecular Weight 43kDa
NCBI Gene Id 23210
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Jumonji domain containing 6
Alias Symbols PSR, PTDSR, PTDSR1
Peptide Sequence Synthetic peptide located within the following region: PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Cao,W.M., (2004) J. Mol. Endocrinol. 32 (2), 497-505
Description of Target PTDSR is required during embryogenesis and differentiation of multiple organs during embryogenesis. PTDSR probably acts as a key regulator of hematopoietic differentiation. PTDSR may not be required for apoptotic cell clearance by macrophages but seems to be necessary for the regulation of macrophage cytokine responses
Protein Interactions NAA50; FRMD6; UBC; C17orf97; RSPO2; STAC3; FAM9A; FGD5; AEBP2; CENPL; PRPF38A; ANKEF1; CCNL1; CAND1; ASUN; NHP2; SLFN12; VPS29; LARP7; ZCCHC17; RSRC1; CYHR1; RANBP6; ZNF451; BRD4; DIP2A; SWAP70; XPO7; SEC24A; SLU7; DNM1L; HMGXB4; GNA14; VPS26A; TAF1A; HIS
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-JMJD6 (ARP31807_P050) antibody
Blocking Peptide For anti-JMJD6 (ARP31807_P050) antibody is Catalog # AAP31807 (Previous Catalog # AAPP02602)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PTDSR
Uniprot ID Q6NYC1-2
Protein Name Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
Protein Accession # NP_055982
Purification Affinity Purified
Nucleotide Accession # NM_015167
Tested Species Reactivity Human
Gene Symbol JMJD6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 100%
Image 1
Human kidney
WB Suggested Anti-PTDSR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human kidney
Image 2
Human Breast
IHC Suggested Anti-PTDSR antibody
Titration: 5ug/ ml
Positive Control: Breast
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com