| Product Number |
ARP31755_P050 |
| Product Page |
www.avivasysbio.com/tlr6-antibody-middle-region-arp31755-p050.html |
| Name |
TLR6 Antibody - middle region (ARP31755_P050) |
| Protein Size (# AA) |
480 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
10333 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Toll-like receptor 6 |
| Alias Symbols |
CD286 |
| Peptide Sequence |
Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
TLR6 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins. |
| Protein Interactions |
BTK; TRAP1; TLR2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TLR6 (ARP31755_P050) antibody |
| Blocking Peptide |
For anti-TLR6 (ARP31755_P050) antibody is Catalog # AAP31755 (Previous Catalog # AAPP23839) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TLR6 |
| Uniprot ID |
Q2NKL3 |
| Protein Name |
TLR6 protein EMBL AAI11756.1 |
| Protein Accession # |
AAI11756 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006068 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TLR6 |
| Predicted Species Reactivity |
Human, Goat, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Goat: 85%; Human: 100%; Sheep: 86% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TLR6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
