Product Number |
ARP31708_T100 |
Product Page |
www.avivasysbio.com/znf609-antibody-n-terminal-region-arp31708-t100.html |
Name |
ZNF609 Antibody - N-terminal region (ARP31708_T100) |
Protein Size (# AA) |
1411 amino acids |
Molecular Weight |
155kDa |
NCBI Gene Id |
23060 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 609 |
Peptide Sequence |
Synthetic peptide located within the following region: NIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFTPSEGAASKKE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Oh,J.H., et al., (2005) Mamm. Genome 16 (12), 942-954 |
Description of Target |
The function of ZNF609 remains unknown. |
Protein Interactions |
UBC; SOX2; HDAC1; ATXN1; Dynll1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF609 (ARP31708_T100) antibody |
Blocking Peptide |
For anti-ZNF609 (ARP31708_T100) antibody is Catalog # AAP31708 (Previous Catalog # AAPP02495) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF609 |
Uniprot ID |
O15014 |
Protein Name |
Zinc finger protein 609 |
Protein Accession # |
NP_055857 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_015042 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF609 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100% |
Image 1 | Human Brain
| WB Suggested Anti-ZNF609 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Human brain |
|
|