FBXL11 Antibody - N-terminal region (ARP31697_P050)

Data Sheet
 
Product Number ARP31697_P050
Product Page www.avivasysbio.com/fbxl11-antibody-n-terminal-region-arp31697-p050.html
Name FBXL11 Antibody - N-terminal region (ARP31697_P050)
Protein Size (# AA) 782 amino acids
Molecular Weight 86kDa
NCBI Gene Id 22992
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lysine (K)-specific demethylase 2A
Alias Symbols FBL7, CXXC8, FBL11, FBXL11, JHDM1A, LILINA
Peptide Sequence Synthetic peptide located within the following region: RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats
Protein Interactions RB1; E2F1; EED; SKP1; MPG; ZNF512B; UBE2G2; SMAD7; SMAD3; HIST3H3; HIST2H3C; KIAA0368; ELAVL1; UBC; BCL6; FOS; RELA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KDM2A (ARP31697_P050) antibody
Blocking Peptide For anti-KDM2A (ARP31697_P050) antibody is Catalog # AAP31697 (Previous Catalog # AAPP02484)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL11
Uniprot ID Q9Y2K7-3
Protein Name Lysine-specific demethylase 2A
Protein Accession # AAH47486
Purification Affinity Purified
Nucleotide Accession # NM_001256405
Tested Species Reactivity Human
Gene Symbol KDM2A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
Human Muscle
HumanMuscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com