FOXF1 Antibody - N-terminal region (ARP31691_T100)

Data Sheet
 
Product Number ARP31691_T100
Product Page www.avivasysbio.com/foxf1-antibody-n-terminal-region-arp31691-t100.html
Name FOXF1 Antibody - N-terminal region (ARP31691_T100)
Protein Size (# AA) 354 amino acids
Molecular Weight 38kDa
NCBI Gene Id 2294
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Forkhead box F1
Alias Symbols FKHL5, ACDMPV, FREAC1
Peptide Sequence Synthetic peptide located within the following region: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Coon,D.R., et al., (2006) Exp. Mol. Pathol. 80 (2), 119-123
Description of Target FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXF1 (ARP31691_T100) antibody
Blocking Peptide For anti-FOXF1 (ARP31691_T100) antibody is Catalog # AAP31691 (Previous Catalog # AAPP02478)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXF1
Uniprot ID Q12946
Protein Name Forkhead box protein F1
Protein Accession # NP_001442
Purification Protein A purified
Nucleotide Accession # NM_001451
Tested Species Reactivity Human
Gene Symbol FOXF1
Predicted Species Reactivity Human, Cow, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 92%
Image 1
Human Jurkat
WB Suggested Anti-FOXF1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com