Product Number |
ARP31691_T100 |
Product Page |
www.avivasysbio.com/foxf1-antibody-n-terminal-region-arp31691-t100.html |
Name |
FOXF1 Antibody - N-terminal region (ARP31691_T100) |
Protein Size (# AA) |
354 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
2294 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Forkhead box F1 |
Alias Symbols |
FKHL5, ACDMPV, FREAC1 |
Peptide Sequence |
Synthetic peptide located within the following region: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Coon,D.R., et al., (2006) Exp. Mol. Pathol. 80 (2), 119-123 |
Description of Target |
FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXF1 (ARP31691_T100) antibody |
Blocking Peptide |
For anti-FOXF1 (ARP31691_T100) antibody is Catalog # AAP31691 (Previous Catalog # AAPP02478) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXF1 |
Uniprot ID |
Q12946 |
Protein Name |
Forkhead box protein F1 |
Protein Accession # |
NP_001442 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001451 |
Tested Species Reactivity |
Human |
Gene Symbol |
FOXF1 |
Predicted Species Reactivity |
Human, Cow, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-FOXF1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|