| Product Number |
ARP31690_P050 |
| Product Page |
www.avivasysbio.com/kin-antibody-middle-region-arp31690-p050.html |
| Name |
KIN Antibody - middle region (ARP31690_P050) |
| Protein Size (# AA) |
393 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
22944 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
KIN, antigenic determinant of recA protein homolog (mouse) |
| Alias Symbols |
BTCD, Rts2, KIN17 |
| Peptide Sequence |
Synthetic peptide located within the following region: LKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Despras,E., et al., (2003) Radiat.Res.159(6),748-758 |
| Description of Target |
Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog. |
| Protein Interactions |
UBC; HECW2; RPA1; PCNA; METTL22; Bud13; RPA2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KIN (ARP31690_P050) antibody |
| Blocking Peptide |
For anti-KIN (ARP31690_P050) antibody is Catalog # AAP31690 (Previous Catalog # AAPP02477) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KIN |
| Uniprot ID |
O60870 |
| Protein Name |
DNA/RNA-binding protein KIN17 |
| Sample Type Confirmation |
KIN is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_036443 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012311 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KIN |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Rabbit: 85%; Rat: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-KIN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: HepG2 cell lysateKIN is supported by BioGPS gene expression data to be expressed in HepG2 |
|
| Image 2 | Human Spermatophore
 | Human Spermatophore |
|
| Image 3 | Human kidney
 | Human kidney |
|
