| Product Number |
ARP31685_T100 |
| Product Page |
www.avivasysbio.com/znf365-antibody-n-terminal-region-arp31685-t100.html |
| Name |
ZNF365 Antibody - N-terminal region (ARP31685_T100) |
| Protein Size (# AA) |
462 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
22891 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 365 |
| Alias Symbols |
UAN, Su48, ZNF365D |
| Peptide Sequence |
Synthetic peptide located within the following region: TSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gianfrancesco,F., et al., (2003) Am. J. Hum. Genet. 72 (6), 1479-1491 |
| Description of Target |
Zinc Finger Protein 365 is a new candidate transcription factor. |
| Protein Interactions |
APP; DISC1; NDE1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF365 (ARP31685_T100) antibody |
| Blocking Peptide |
For anti-ZNF365 (ARP31685_T100) antibody is Catalog # AAP31685 (Previous Catalog # AAPP02472) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF365 |
| Uniprot ID |
Q70YC5 |
| Protein Name |
Protein ZNF365 |
| Protein Accession # |
NP_955523 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_199451 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF365 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF365 Antibody Titration: 1.2ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
