Product Number |
ARP31678_P050 |
Product Page |
www.avivasysbio.com/znf652-antibody-n-terminal-region-arp31678-p050.html |
Name |
ZNF652 Antibody - N-terminal region (ARP31678_P050) |
Protein Size (# AA) |
606 amino acids |
Molecular Weight |
70kDa |
NCBI Gene Id |
22834 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 652 |
Peptide Sequence |
Synthetic peptide located within the following region: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nagase,T., et al., (1999) DNA Res. 6 (1), 63-70 |
Description of Target |
ZNF652 is a new candidate transcription factor. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF652 (ARP31678_P050) antibody |
Blocking Peptide |
For anti-ZNF652 (ARP31678_P050) antibody is Catalog # AAP31678 (Previous Catalog # AAPP02465) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF652 |
Uniprot ID |
Q9Y2D9 |
Protein Name |
Zinc finger protein 652 |
Sample Type Confirmation |
ZNF652 is supported by BioGPS gene expression data to be expressed in HeLa |
Protein Accession # |
NP_055712 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014897 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF652 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Yeast |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 88%; Dog: 93%; Goat: 91%; Horse: 87%; Human: 100%; Mouse: 93%; Pig: 78%; Rabbit: 90%; Rat: 93%; Yeast: 91% |
Image 1 | Human HeLa
| WB Suggested Anti-ZNF652 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysateZNF652 is supported by BioGPS gene expression data to be expressed in HeLa |
| Image 2 | Human Lung
| Rabbit Anti-ZNF652 antibody Catalog Number: ARP31678_P050 Paraffin Embedded Tissue: Human Lung cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
|