ZNF652 Antibody - N-terminal region (ARP31678_P050)

Data Sheet
 
Product Number ARP31678_P050
Product Page www.avivasysbio.com/znf652-antibody-n-terminal-region-arp31678-p050.html
Name ZNF652 Antibody - N-terminal region (ARP31678_P050)
Protein Size (# AA) 606 amino acids
Molecular Weight 70kDa
NCBI Gene Id 22834
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 652
Peptide Sequence Synthetic peptide located within the following region: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nagase,T., et al., (1999) DNA Res. 6 (1), 63-70
Description of Target ZNF652 is a new candidate transcription factor.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF652 (ARP31678_P050) antibody
Blocking Peptide For anti-ZNF652 (ARP31678_P050) antibody is Catalog # AAP31678 (Previous Catalog # AAPP02465)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF652
Uniprot ID Q9Y2D9
Protein Name Zinc finger protein 652
Sample Type Confirmation

ZNF652 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_055712
Purification Affinity Purified
Nucleotide Accession # NM_014897
Tested Species Reactivity Human
Gene Symbol ZNF652
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Yeast
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 88%; Dog: 93%; Goat: 91%; Horse: 87%; Human: 100%; Mouse: 93%; Pig: 78%; Rabbit: 90%; Rat: 93%; Yeast: 91%
Image 1
Human HeLa
WB Suggested Anti-ZNF652 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysateZNF652 is supported by BioGPS gene expression data to be expressed in HeLa
Image 2
Human Lung
Rabbit Anti-ZNF652 antibody
Catalog Number: ARP31678_P050
Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com