| Product Number |
ARP31673_P050 |
| Product Page |
www.avivasysbio.com/fgd1-antibody-c-terminal-region-arp31673-p050.html |
| Name |
FGD1 Antibody - C-terminal region (ARP31673_P050) |
| Protein Size (# AA) |
961 amino acids |
| Molecular Weight |
107kDa |
| NCBI Gene Id |
2245 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
FYVE, RhoGEF and PH domain containing 1 |
| Alias Symbols |
AAS, FGDY, MRXS16, ZFYVE3 |
| Peptide Sequence |
Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lebel,R.R., et al., (2002) Clin. Genet. 61 (2), 139-145 |
| Description of Target |
FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome. |
| Protein Interactions |
BTRC; UBC; ELAVL1; ELMO1; CTTN; CDC42; AOC1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FGD1 (ARP31673_P050) antibody |
| Blocking Peptide |
For anti-FGD1 (ARP31673_P050) antibody is Catalog # AAP31673 (Previous Catalog # AAPP02460) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FGD1 |
| Uniprot ID |
P98174 |
| Protein Name |
FYVE, RhoGEF and PH domain-containing protein 1 |
| Sample Type Confirmation |
FGD1 is supported by BioGPS gene expression data to be expressed in Raji |
| Protein Accession # |
NP_004454 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004463 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FGD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86% |
| Image 1 | Human Heart
 | Rabbit Anti-FGD1 Antibody
Catalog Number: ARP31673
Paraffin Embedded Tissue: Human cardiac cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Raji
 | WB Suggested Anti-FGD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Raji cell lysateFGD1 is supported by BioGPS gene expression data to be expressed in Raji |
|
| Image 3 | Human Testis
 | Rabbit Anti-FGD1 antibody
Catalog Number: ARP31673
Formalin Fixed Paraffin Embedded Tissue: Human Testis
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
