| Product Number |
ARP31648_P050 |
| Product Page |
www.avivasysbio.com/lass3-antibody-n-terminal-region-arp31648-p050.html |
| Name |
LASS3 Antibody - N-terminal region (ARP31648_P050) |
| Protein Size (# AA) |
383 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
204219 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ceramide synthase 3 |
| Alias Symbols |
ARCI9, LASS3 |
| Peptide Sequence |
Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R., (2002) unpublished |
| Description of Target |
The gene encoding the hypothetical protein LASS3 is located on chromosome 15. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-CERS3 (ARP31648_P050) antibody |
| Blocking Peptide |
For anti-CERS3 (ARP31648_P050) antibody is Catalog # AAP31648 (Previous Catalog # AAPP02435) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LASS3 |
| Uniprot ID |
Q8IU89 |
| Protein Name |
Ceramide synthase 3 |
| Protein Accession # |
NP_849164 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178842 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CERS3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 77%; Rat: 77% |
| Image 1 | Human Liver
 | WB Suggested Anti-LASS3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Liver |
|
|
