website statistics
Product Datasheet: ARP31643_P050 - EMX2 Antibody - N-terminal region (ARP31643_P050) - Aviva Systems Biology
 
EMX2 Antibody - N-terminal region (ARP31643_P050)
Data Sheet
 
Product Number ARP31643_P050
Product Page www.avivasysbio.com/emx2-antibody-n-terminal-region-arp31643-p050.html
Product Name EMX2 Antibody - N-terminal region (ARP31643_P050)
Size 100 ul
Gene Symbol EMX2
Alias Symbols -
Protein Size (# AA) 252 amino acids
Molecular Weight 28kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 2018
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Empty spiracles homeobox 2
Description This is a rabbit polyclonal antibody against EMX2. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG
Description of Target The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head.
Protein Interactions GTF2A1L; TLE2; MEIS1; EIF4E;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-EMX2 (ARP31643_P050) antibody is Catalog # AAP31643
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMX2
Complete computational species homology data Anti-EMX2 (ARP31643_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EMX2.
Swissprot Id Q04743
Protein Name Homeobox protein EMX2
Protein Accession # NP_004089
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EMX2.
Nucleotide Accession # NM_004098
Replacement Item This antibody may replace item sc-19956 from Santa Cruz Biotechnology.
Conjugation Options

ARP31643_P050-FITC Conjugated

ARP31643_P050-HRP Conjugated

ARP31643_P050-Biotin Conjugated

CB Replacement sc-19956; sc-19957; sc-28221; sc-38737; sc-38738
CB Tag neuroscience
Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Brain, cerebellum
Rabbit Anti-EMX2 Antibody
Catalog Number: ARP31643
Paraffin Embedded Tissue: Human Brain, cerebellum
Antibody Concentration: 5 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-EMX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 3
Human Muscle
Rabbit Anti-EMX2 Antibody
Catalog Number: ARP31643
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com