Product Number |
ARP31643_P050 |
Product Page |
www.avivasysbio.com/emx2-antibody-n-terminal-region-arp31643-p050.html |
Name |
EMX2 Antibody - N-terminal region (ARP31643_P050) |
Protein Size (# AA) |
252 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
2018 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Empty spiracles homeobox 2 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head. |
Protein Interactions |
GTF2A1L; TLE2; MEIS1; EIF4E; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EMX2 (ARP31643_P050) antibody |
Blocking Peptide |
For anti-EMX2 (ARP31643_P050) antibody is Catalog # AAP31643 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMX2 |
Uniprot ID |
Q04743 |
Protein Name |
Homeobox protein EMX2 |
Protein Accession # |
NP_004089 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004098 |
Tested Species Reactivity |
Human |
Gene Symbol |
EMX2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human Brain, cerebellum
| Rabbit Anti-EMX2 Antibody Catalog Number: ARP31643 Paraffin Embedded Tissue: Human Brain, cerebellum Antibody Concentration: 5 ug/ml Magnification: 400X |
|
Image 2 | Human HepG2
| WB Suggested Anti-EMX2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
Image 3 | Human Muscle
| Rabbit Anti-EMX2 Antibody Catalog Number: ARP31643 Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|