EMX2 Antibody - N-terminal region (ARP31643_P050)

Data Sheet
 
Product Number ARP31643_P050
Product Page www.avivasysbio.com/emx2-antibody-n-terminal-region-arp31643-p050.html
Name EMX2 Antibody - N-terminal region (ARP31643_P050)
Protein Size (# AA) 252 amino acids
Molecular Weight 28kDa
NCBI Gene Id 2018
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Empty spiracles homeobox 2
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head.
Protein Interactions GTF2A1L; TLE2; MEIS1; EIF4E;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EMX2 (ARP31643_P050) antibody
Blocking Peptide For anti-EMX2 (ARP31643_P050) antibody is Catalog # AAP31643
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMX2
Uniprot ID Q04743
Protein Name Homeobox protein EMX2
Protein Accession # NP_004089
Purification Affinity Purified
Nucleotide Accession # NM_004098
Tested Species Reactivity Human
Gene Symbol EMX2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Brain, cerebellum
Rabbit Anti-EMX2 Antibody
Catalog Number: ARP31643
Paraffin Embedded Tissue: Human Brain, cerebellum
Antibody Concentration: 5 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-EMX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 3
Human Muscle
Rabbit Anti-EMX2 Antibody
Catalog Number: ARP31643
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com