E2F2 Antibody - middle region (ARP31611_P050)

Data Sheet
 
Product Number ARP31611_P050
Product Page www.avivasysbio.com/e2f2-antibody-middle-region-arp31611-p050.html
Name E2F2 Antibody - middle region (ARP31611_P050)
Protein Size (# AA) 437 amino acids
Molecular Weight 48kDa
NCBI Gene Id 1870
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name E2F transcription factor 2
Alias Symbols E2F-2
Peptide Sequence Synthetic peptide located within the following region: QWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Maruyama,K., et al., (2003) Hum. Mol. Genet. 12 (4), 423-433
Description of Target E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F pro
Protein Interactions RB1; GNB5; GIT2; TFDP1; RBL1; ARID3A; ELAVL1; ATAD2; KMT2D; KMT2A; RYBP; SETD8; BCAR1; TFDP2; BRD2; YY1; SP1; CDK3; RNF144A; FHL2; SPIB; RBL2; E2F4; MYBL2; EAPP; TP53BP2; PPP1R13B; TP53INP1; JMY; GAB2; CDC25A; CDC6; E2F1; UXT; MT1G;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-E2F2 (ARP31611_P050) antibody
Blocking Peptide For anti-E2F2 (ARP31611_P050) antibody is Catalog # AAP31611 (Previous Catalog # AAPP02393)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human E2F2
Uniprot ID Q14209
Protein Name Transcription factor E2F2
Sample Type Confirmation

E2F2 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_004082
Purification Affinity Purified
Nucleotide Accession # NM_004091
Tested Species Reactivity Human
Gene Symbol E2F2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 90%; Rabbit: 86%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-E2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateE2F2 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com