DLX2 Antibody - N-terminal region (ARP31604_T100)

• Product Number: ARP31604_T100
• Name: DLX2 Antibody - N-terminal region (ARP31604_T100)
• Protein Size (# AA): 328 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 1746
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Distal-less homeobox 2
• Alias Symbols: TES1, TES-1
• Peptide Sequence: Synthetic peptide located within the following region: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: McGuinness,T., et al., (1996) Genomics 35 (3), 473-485
• Description of Target: Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.
• Protein Interactions: GRN; PARK2; AVP; MVP; BZRAP1; DGCR6; PIK3R1; SUMO3; UBC; NCOA2; DIP2A; MSX2; MSX1; HOXC8; DLX5; DLX2; XRCC6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DLX2 (ARP31604_T100) antibody is Catalog # AAP31604 (Previous Catalog # AAPP02385)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DLX2
• Uniprot ID: Q07687
• Protein Name: Homeobox protein DLX-2
• Protein Accession #: NP_004396
• Purification: Protein A purified
• Nucleotide Accession #: NM_004405
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: DLX2
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Guinea Pig, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 87%; Dog: 92%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-DLX2 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate
• Image 2: Mouse, Rat
  
  Lanes:
  1. Mouse WT brain extract (80ug) 2. Rat brain extract (80ug)
  Primary Antibody Dilution:
  2ug/ml
  Secondary Antibody:
  IRDye 800CW goat anti-rabbit from Li-COR Bioscience
  Secondary Antibody Dilution:
  1: 20,000
  Gene Name:
  DLX2
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science
  
• Image 3: Human Muscle
  
  HumanMuscle