| Product Number |
ARP31552_P050 |
| Product Page |
www.avivasysbio.com/zbtb8-antibody-c-terminal-region-arp31552-p050.html |
| Name |
ZBTB8 Antibody - C-terminal region (ARP31552_P050) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
127557 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 8 |
| Alias Symbols |
BOZF1, FLJ90065, MGC17919 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDND |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZBTB8 may be involved in transcriptional regulation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB8 (ARP31552_P050) antibody |
| Blocking Peptide |
For anti-ZBTB8 (ARP31552_P050) antibody is Catalog # AAP31552 (Previous Catalog # AAPP02328) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the c terminal region of human ZBTB8 |
| Uniprot ID |
Q8NAP8 |
| Protein Name |
Zinc finger and BTB domain-containing protein 8B |
| Protein Accession # |
NP_001139192 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001145720 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100% |
| Image 1 | Human THP-1
 | WB Suggested Anti-ZBTB8 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate |
|
|
