Product Number |
ARP31539_P050 |
Product Page |
www.avivasysbio.com/osr2-antibody-n-terminal-region-arp31539-p050.html |
Name |
OSR2 Antibody - N-terminal region (ARP31539_P050) |
Protein Size (# AA) |
276 amino acids |
Molecular Weight |
31kDa |
NCBI Gene Id |
116039 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Odd-skipped related 2 (Drosophila) |
Peptide Sequence |
Synthetic peptide located within the following region: YSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTIT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lan,Y., et al., (2004) Development 131 (13), 3207-3216 |
Description of Target |
Osr2 is a zinc finger containing protein related to Drosophila Odd-skipped. Its mRNA expression is specifically activated in the nascent palatal mesenchyme at the onset of palatal outgrowth. Osr2 mutants exhibit altered gene expression patterns, including those of Osr1, Pax9 and Tgfb3, during palate development. |
Protein Interactions |
PSMA3; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-OSR2 (ARP31539_P050) antibody |
Blocking Peptide |
For anti-OSR2 (ARP31539_P050) antibody is Catalog # AAP31539 (Previous Catalog # AAPP02312) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human OSR2 |
Uniprot ID |
Q8N2R0 |
Protein Name |
Protein odd-skipped-related 2 |
Protein Accession # |
NP_443727 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_053001 |
Tested Species Reactivity |
Human |
Gene Symbol |
OSR2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
Image 1 | Human HeLa
| WB Suggested Anti-OSR2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Hela cell lysate |
|
|