OSR2 Antibody - N-terminal region (ARP31539_P050)

Data Sheet
 
Product Number ARP31539_P050
Product Page www.avivasysbio.com/osr2-antibody-n-terminal-region-arp31539-p050.html
Name OSR2 Antibody - N-terminal region (ARP31539_P050)
Protein Size (# AA) 276 amino acids
Molecular Weight 31kDa
NCBI Gene Id 116039
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Odd-skipped related 2 (Drosophila)
Peptide Sequence Synthetic peptide located within the following region: YSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTIT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lan,Y., et al., (2004) Development 131 (13), 3207-3216
Description of Target Osr2 is a zinc finger containing protein related to Drosophila Odd-skipped. Its mRNA expression is specifically activated in the nascent palatal mesenchyme at the onset of palatal outgrowth. Osr2 mutants exhibit altered gene expression patterns, including those of Osr1, Pax9 and Tgfb3, during palate development.
Protein Interactions PSMA3; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OSR2 (ARP31539_P050) antibody
Blocking Peptide For anti-OSR2 (ARP31539_P050) antibody is Catalog # AAP31539 (Previous Catalog # AAPP02312)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OSR2
Uniprot ID Q8N2R0
Protein Name Protein odd-skipped-related 2
Protein Accession # NP_443727
Purification Affinity Purified
Nucleotide Accession # NM_053001
Tested Species Reactivity Human
Gene Symbol OSR2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human HeLa
WB Suggested Anti-OSR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com