TNRC4 Antibody - N-terminal region (ARP31525_P050)

Data Sheet
 
Product Number ARP31525_P050
Product Page www.avivasysbio.com/tnrc4-antibody-n-terminal-region-arp31525-p050.html
Name TNRC4 Antibody - N-terminal region (ARP31525_P050)
Protein Size (# AA) 465 amino acids
Molecular Weight 51kDa
NCBI Gene Id 11189
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CUGBP, Elav-like family member 3
Alias Symbols CAGH4, ERDA4, ETR-1, TNRC4, BRUNOL1
Peptide Sequence Synthetic peptide located within the following region: MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ladd,A.N., (2001) Mol. Cell. Biol. 21 (4), 1285-1296
Description of Target Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. While several transcript variants may exist for this gene, the full-length nature of only one has been biologically validated to date.
Protein Interactions RBFOX1; PCBP1; CDKN1A; ANXA7; SOBP; C14orf1; TLE1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CELF3 (ARP31525_P050) antibody
Blocking Peptide For anti-CELF3 (ARP31525_P050) antibody is Catalog # AAP31525 (Previous Catalog # AAPP24092)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TNRC4
Uniprot ID Q5SZQ8
Protein Name CUGBP Elav-like family member 3
Protein Accession # NP_009116
Purification Affinity Purified
Nucleotide Accession # NM_007185
Tested Species Reactivity Human
Gene Symbol CELF3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com