Product Number |
ARP31525_P050 |
Product Page |
www.avivasysbio.com/tnrc4-antibody-n-terminal-region-arp31525-p050.html |
Name |
TNRC4 Antibody - N-terminal region (ARP31525_P050) |
Protein Size (# AA) |
465 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
11189 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
CUGBP, Elav-like family member 3 |
Alias Symbols |
CAGH4, ERDA4, ETR-1, TNRC4, BRUNOL1 |
Peptide Sequence |
Synthetic peptide located within the following region: MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ladd,A.N., (2001) Mol. Cell. Biol. 21 (4), 1285-1296 |
Description of Target |
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. While several transcript variants may exist for this gene, the full-length nature of only one has been biologically validated to date. |
Protein Interactions |
RBFOX1; PCBP1; CDKN1A; ANXA7; SOBP; C14orf1; TLE1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CELF3 (ARP31525_P050) antibody |
Blocking Peptide |
For anti-CELF3 (ARP31525_P050) antibody is Catalog # AAP31525 (Previous Catalog # AAPP24092) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TNRC4 |
Uniprot ID |
Q5SZQ8 |
Protein Name |
CUGBP Elav-like family member 3 |
Protein Accession # |
NP_009116 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007185 |
Tested Species Reactivity |
Human |
Gene Symbol |
CELF3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|