Product Number |
ARP31513_T100 |
Product Page |
www.avivasysbio.com/ripk3-antibody-n-terminal-region-arp31513-t100.html |
Name |
RIPK3 Antibody - N-terminal region (ARP31513_T100) |
Protein Size (# AA) |
518 amino acids |
Molecular Weight |
57 kDa |
Conjugation |
Unconjugated |
NCBI Gene Id |
11035 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Receptor-interacting serine-threonine kinase 3 |
Description |
|
Alias Symbols |
RIP3 |
Peptide Sequence |
Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. |
Protein Interactions |
BMH1; RFX6; FADD; RIPK1; CASP8; INPP5K; CDC37; STIP1; PYGL; FKBP5; FKBP4; CTNND1; UBC; XIAP; BIRC3; BIRC2; TICAM1; TRAF2; TNFRSF1A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-RIPK3 (ARP31513_T100) antibody |
Blocking Peptide |
For anti-RIPK3 (ARP31513_T100) antibody is Catalog # AAP31513 (Previous Catalog # AAPP24084) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3 |
Uniprot ID |
Q9Y572 |
Protein Name |
Receptor-interacting serine/threonine-protein kinase 3 |
Publications |
Mesenchymal Stem/Stromal Cells and their Extracellular Vesicle Progeny Decrease Injury in Poststenotic Swine Kidney Through Different Mechanisms. Stem Cells Dev. 29, 1190-1200 (2020) |
Protein Accession # |
NP_006862 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006871 |
Tested Species Reactivity |
Human |
Gene Symbol |
RIPK3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 91% |
Image 1 | Human Liver
| Human Liver |
|
Image 2 | Human Heart
| Human Heart |
|
Image 3 | Human Pancreas
| RIPK3 antibody - N-terminal region (ARP31513_T100)
Catalog Number: ARP31513_T100
Formalin Fixed Paraffin Embedded Tissue: Human Pancreas Tissue
Observed Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cells
Primary Antibody Concentration: 3 -12 ug/ml
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure: 0.2 seconds
|
|
Image 4 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|