Product Number |
ARP31500_P050 |
Product Page |
www.avivasysbio.com/tcfl5-antibody-middle-region-arp31500-p050.html |
Name |
TCFL5 Antibody - middle region (ARP31500_P050) |
Protein Size (# AA) |
500 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
10732 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcription factor-like 5 (basic helix-loop-helix) |
Alias Symbols |
CHA, Figlb, SOSF1, E2BP-1, bHLHe82 |
Peptide Sequence |
Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Rodriguez,C.I., et al., (2003) J. Biol. Chem. 278 (44), 43135-43145 |
Description of Target |
TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription. |
Protein Interactions |
USF1; TOPBP1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TCFL5 (ARP31500_P050) antibody |
Blocking Peptide |
For anti-TCFL5 (ARP31500_P050) antibody is Catalog # AAP31500 (Previous Catalog # AAPP02262) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TCFL5 |
Uniprot ID |
Q9UL49 |
Protein Name |
Transcription factor-like 5 protein |
Sample Type Confirmation |
TCFL5 is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_006593 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006602 |
Tested Species Reactivity |
Human |
Gene Symbol |
TCFL5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93% |
Image 1 | Human kidney
| Human kidney |
|
Image 2 | Human HepG2
| WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysateTCFL5 is supported by BioGPS gene expression data to be expressed in HepG2 |
|