TCFL5 Antibody - middle region (ARP31500_P050)

Data Sheet
 
Product Number ARP31500_P050
Product Page www.avivasysbio.com/tcfl5-antibody-middle-region-arp31500-p050.html
Name TCFL5 Antibody - middle region (ARP31500_P050)
Protein Size (# AA) 500 amino acids
Molecular Weight 53kDa
NCBI Gene Id 10732
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor-like 5 (basic helix-loop-helix)
Alias Symbols CHA, Figlb, SOSF1, E2BP-1, bHLHe82
Peptide Sequence Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rodriguez,C.I., et al., (2003) J. Biol. Chem. 278 (44), 43135-43145
Description of Target TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.
Protein Interactions USF1; TOPBP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCFL5 (ARP31500_P050) antibody
Blocking Peptide For anti-TCFL5 (ARP31500_P050) antibody is Catalog # AAP31500 (Previous Catalog # AAPP02262)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TCFL5
Uniprot ID Q9UL49
Protein Name Transcription factor-like 5 protein
Sample Type Confirmation

TCFL5 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_006593
Purification Affinity Purified
Nucleotide Accession # NM_006602
Tested Species Reactivity Human
Gene Symbol TCFL5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateTCFL5 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com