| Product Number |
ARP31478_P050 |
| Product Page |
www.avivasysbio.com/cdx4-antibody-middle-region-arp31478-p050.html |
| Name |
CDX4 Antibody - middle region (ARP31478_P050) |
| Protein Size (# AA) |
284 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
1046 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Caudal type homeobox 4 |
| Peptide Sequence |
Synthetic peptide located within the following region: TDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Nibbs,R.J., (2003) Bioessays 25 (10), 971-980 |
| Description of Target |
CDX are homeodomain transcription factors related to the Drosophila caudal gene. The vertebrate CDX have been implicated in the development of the posterior embryo. Several signaling molecules, notably retinoic acid (RA) and members of the Wnt (wingless) and fibroblast growth factor (FGF) families, are also implicated in patterning of the posterior vertebrate embryo. CDX family is the target of Wnt, RA and FGF signaling, suggesting that CDX factors act to convey the activity of these signaling molecules to Hox genes. |
| Protein Interactions |
PRKAB2; PRKAA1; LMO2; LMO1; CKS1B; PITX1; HOXA5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CDX4 (ARP31478_P050) antibody |
| Blocking Peptide |
For anti-CDX4 (ARP31478_P050) antibody is Catalog # AAP31478 (Previous Catalog # AAPP24068) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CDX4 |
| Uniprot ID |
O14627 |
| Protein Name |
Homeobox protein CDX-4 |
| Protein Accession # |
NP_005184 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005193 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CDX4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CDX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Muscle
 | HumanMuscle |
|
|
