Product Number |
ARP31477_P050 |
Product Page |
www.avivasysbio.com/slc30a9-antibody-n-terminal-region-arp31477-p050.html |
Name |
SLC30A9 Antibody - N-terminal region (ARP31477_P050) |
Protein Size (# AA) |
568 amino acids |
Molecular Weight |
63kDa |
NCBI Gene Id |
10463 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Solute carrier family 30 (zinc transporter), member 9 |
Alias Symbols |
HUEL, ZNT9, GAC63, C4orf1, BILAPES |
Peptide Sequence |
Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sim del, L.C., et al., (2002) Int.J.Biochem.CellBiol.34(5),487-504 |
Description of Target |
The gene corresponding to embryonic lung protein [also known as Solute carrier family 30 (Zinc transporter), member 9, SLC30A9], is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation. |
Protein Interactions |
DHX15; ELAVL1; UBC; NCOA2; ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC30A9 (ARP31477_P050) antibody |
Blocking Peptide |
For anti-SLC30A9 (ARP31477_P050) antibody is Catalog # AAP31477 (Previous Catalog # AAPP02239) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC30A9 |
Uniprot ID |
Q9Y6R2 |
Protein Name |
Zinc transporter 9 |
Protein Accession # |
NP_006336 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006345 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC30A9 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human HepG2
| WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
Image 2 | Human Liver
| Human Liver |
|