SLC30A9 Antibody - N-terminal region (ARP31477_P050)

Data Sheet
 
Product Number ARP31477_P050
Product Page www.avivasysbio.com/slc30a9-antibody-n-terminal-region-arp31477-p050.html
Name SLC30A9 Antibody - N-terminal region (ARP31477_P050)
Protein Size (# AA) 568 amino acids
Molecular Weight 63kDa
NCBI Gene Id 10463
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Solute carrier family 30 (zinc transporter), member 9
Alias Symbols HUEL, ZNT9, GAC63, C4orf1, BILAPES
Peptide Sequence Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sim del, L.C., et al., (2002) Int.J.Biochem.CellBiol.34(5),487-504
Description of Target The gene corresponding to embryonic lung protein [also known as Solute carrier family 30 (Zinc transporter), member 9, SLC30A9], is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.
Protein Interactions DHX15; ELAVL1; UBC; NCOA2; ESR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC30A9 (ARP31477_P050) antibody
Blocking Peptide For anti-SLC30A9 (ARP31477_P050) antibody is Catalog # AAP31477 (Previous Catalog # AAPP02239)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC30A9
Uniprot ID Q9Y6R2
Protein Name Zinc transporter 9
Protein Accession # NP_006336
Purification Affinity Purified
Nucleotide Accession # NM_006345
Tested Species Reactivity Human
Gene Symbol SLC30A9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human HepG2
WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
Human Liver
Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com