HDAC6 antibody - N-terminal region (ARP31451_P050)
Data Sheet
Product Number ARP31451_P050
Product Page www.avivasysbio.com/hdac6-antibody-n-terminal-region-arp31451-p050.html
Product Name HDAC6 antibody - N-terminal region (ARP31451_P050)
Gene Symbol HDAC6
Protein Size (# AA) 1215 amino acids
Molecular Weight 131kDa, 17 kD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Official Gene Full Name Histone deacetylase 6
Alias Symbols HD6, JM21
NCBI Gene Id 10013
Thumbnail Label Human 293T
Host Rabbit
Clonality Polyclonal
Size 100 ul
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Description This is a rabbit polyclonal antibody against HDAC6. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ
Target Reference Int J Mol Med. 2003 Jul;12(1):87-93.
Description of Target Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-HDAC6 (ARP31451_P050) antibody is Catalog # AAP31451 (Previous Catalog # AAPP02213)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HDAC6
Complete computational species homology data Anti-HDAC6 (ARP31451_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HDAC6.
Swissprot Id Q9UBN7
Protein Name HDAC6 protein EMBL AAH05872.1
Sample Type Confirmation

There is BioGPS gene expression data showing that HDAC6 is expressed in HEK293T

Protein Accession # AAH05872
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HDAC6.
Nucleotide Accession # NM_006044
Replacement Item This antibody may replace item sc-11420 from Santa Cruz Biotechnology.
Conjugation Options

ARP31451_P050-FITC Conjugated

ARP31451_P050-HRP Conjugated

ARP31451_P050-Biotin Conjugated

CB Replacement sc-11420; sc-28386; sc-5255; sc-5258
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Application WB, CHIP, IHC
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%
Image 1
Chromatin Immunoprecipitation (ChIP) Using HDAC6 antibody - N-terminal region (ARP31451_P050) and HCT116 Cells
Image 2
Human 293T
WB Suggested Anti-HDAC6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

There is BioGPS gene expression data showing that HDAC6 is expressed in HEK293T

Image 3
Rabbit Anti-HDAC6 Antibody
Catalog Number: ARP31451_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Cytoplasmic,Nuclear
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
Image 4
Human Kidney
Rabbit Anti-HDAC6 Antibody
Catalog Number: ARP31451_P050
Formalin Fixed Paraffin Embedded Tissue: Human Kidney Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com