GTF2H3 Antibody - N-terminal region (ARP31438_P050)

Data Sheet
 
Product Number ARP31438_P050
Product Page www.avivasysbio.com/gtf2h3-antibody-n-terminal-region-arp31438-p050.html
Name GTF2H3 Antibody - N-terminal region (ARP31438_P050)
Protein Size (# AA) 308 amino acids
Molecular Weight 34kDa
Subunit 3
NCBI Gene Id 2967
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name General transcription factor IIH, polypeptide 3, 34kDa
Alias Symbols P34, BTF2, TFB4, TFIIH
Peptide Sequence Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhou,M., et al., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (22), 12666-12671
Description of Target GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.
Protein Interactions GTF2H2C_2; UBC; RPA3; RPA2; RPA1; CDK7; HEATR5A; MNAT1; GTF2H4; GTF2H2; GTF2H1; ERCC3; XBP1P1; ERCC2; AR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF2H3 (ARP31438_P050) antibody
Blocking Peptide For anti-GTF2H3 (ARP31438_P050) antibody is Catalog # AAP31438 (Previous Catalog # AAPP03132)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H3
Uniprot ID Q13889
Protein Name General transcription factor IIH subunit 3
Sample Type Confirmation

GTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001507
Purification Affinity Purified
Nucleotide Accession # NM_001516
Tested Species Reactivity Human
Gene Symbol GTF2H3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Jurkat cell lysateGTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human Muscle
HumanMuscle
Image 3
Human Heart
Rabbit Anti-GTF2H3 antibody
Catalog Number: ARP31438
Paraffin Embedded Tissue: Human Heart
cell Cellular Data: cardiac cell
Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com