GTF2F2 antibody - C-terminal region (ARP31436_P050)
Data Sheet
 
Product Number ARP31436_P050
Product Page www.avivasysbio.com/gtf2f2-antibody-c-terminal-region-arp31436-p050.html
Product Name GTF2F2 antibody - C-terminal region (ARP31436_P050)
Size 100 ul
Gene Symbol GTF2F2
Alias Symbols BTF4, RAP30, TF2F2, TFIIF
Protein Size (# AA) 249 amino acids
Molecular Weight 28kDa
Subunit 2
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 2963
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name General transcription factor IIF, polypeptide 2, 30kDa
Description This is a rabbit polyclonal antibody against GTF2F2. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD
Target Reference Heng,HH., et al., (1994) Hum. Mol. Genet. 3 (1), 61-64
Description of Target GTF2F2 synergizes with HIV-1 Tat and the cellular coactivator Tat-SF1 during Tat-mediated transactivation of the HIV-1 LTR promoter. This gene is required for both basal and HIV-1 Tat-activated transcription.
Protein Interactions UBC; EFTUD2; SHMT1; SH3GL1; HECW2; RPL27A; TCTEX1D2; LMNA; HMGA1; GTF2B; TAF10; TAF5; TAF4; POLR2C; GTF2F1; GPRC5A; SUPT5H; tat; POLR2J; MED29; CTDP1; BAG6; POLR2H; POLR2G; POLR2B; POLR2A; TRAM2; POLR2E; URI1; ATF4; KLF5; AHR; TBP; AR; HTATSF1; GTF2F2; GT
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-GTF2F2 (ARP31436_P050) antibody is Catalog # AAP31436 (Previous Catalog # AAPP03116)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2F2
Complete computational species homology data Anti-GTF2F2 (ARP31436_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GTF2F2.
Swissprot Id P13984
Protein Name General transcription factor IIF subunit 2
Protein Accession # NP_004119
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GTF2F2.
Nucleotide Accession # NM_004128
Replacement Item This antibody may replace item sc-134081 from Santa Cruz Biotechnology.
Conjugation Options

ARP31436_P050-FITC Conjugated

ARP31436_P050-HRP Conjugated

ARP31436_P050-Biotin Conjugated

CB Replacement sc-134081; sc-136408; sc-292295; sc-374304; sc-38521; sc-38522; sc-69028; sc-69030
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human kidney
Human kidney
Image 2
Human Liver
WB Suggested Anti-GTF2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com